PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G20640.1
Common NameF2D10.12, NLP4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Nin-like
Protein Properties Length: 844aa    MW: 94231.9 Da    PI: 5.4545
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G20640.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.94.9e-29556606252
       RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                   k+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  AT1G20640.1 556 DKTITLDVLRQYFAGSLKDAAKNIGVCPTTLKRICRQHGIQRWPSRKIKKV 606
                  689**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.154540626IPR003035RWP-RK domain
PfamPF020423.3E-25558606IPR003035RWP-RK domain
SuperFamilySSF542771.45E-22735832No hitNo description
PROSITE profilePS5174529.412744827IPR000270PB1 domain
SMARTSM006661.2E-25744827IPR000270PB1 domain
PfamPF005641.7E-19745826IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2406.3E-21745824No hitNo description
CDDcd064076.95E-43745826No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009877Biological Processnodulation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001016developmental stageL mature pollen stage
PO:0001017developmental stageM germinated pollen stage
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 844 aa     Download sequence    Send to blast
MEDSFLQSEN VVMDADFMDG LLLDGCWLET TDGSEFLNIA PSTSSVSPFD PTSFMWSPTQ  60
DTSALCTSGV VSQMYGQDCV ERSSLDEFQW NKRWWIGPGG GGSSVTERLV QAVEHIKDYT  120
TARGSLIQLW VPVNRGGKRV LTTKEQPFSH DPLCQRLANY REISVNYHFS AEQDDSKALA  180
GLPGRVFLGK LPEWTPDVRF FKSEEYPRVH HAQDCDVRGT LAIPVFEQGS KICLGVIEVV  240
MTTEMVKLRP ELESICRALQ AVDLRSTELP IPPSLKGCDL SYKAALPEIR NLLRCACETH  300
KLPLAQTWVS CQQQNKSGCR HNDENYIHCV STIDDACYVG DPTVREFHEA CSEHHLLKGQ  360
GVAGQAFLTN GPCFSSDVSN YKKSEYPLSH HANMYGLHGA VAIRLRCIHT GSADFVLEFF  420
LPKDCDDLEE QRKMLNALST IMAHVPRSLR TVTDKELEEE SEVIEREEIV TPKIENASEL  480
HGNSPWNASL EEIQRSNNTS NPQNLGLVFD GGDKPNDGFG LKRGFDYTMD SNVNESSTFS  540
SGGFSMMAEK KRTKADKTIT LDVLRQYFAG SLKDAAKNIG VCPTTLKRIC RQHGIQRWPS  600
RKIKKVGHSL QKIQRVIDSV QGVSGPLPIG SFYANFPNLV SQSQEPSQQA KTTPPPPPPV  660
QLAKSPVSSY SHSSNSSQCC SSETQLNSGA TTDPPSTDVG GALKKTSSEI ELQSSSLDET  720
ILTLSSLENI PQGTNLLSSQ DDDFLRIKVS YGEEKIRLRM RNSRRLRDLL WEIGKRFSIE  780
DMSRYDLKYL DEDNEWVLLT CDEDVEECVD VCRTTPSHTI KLLLQASSHH FPERSSATEY  840
SLWH
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.416990.0flower
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible259540_at0.0
Expression AtlasAT1G20640-
AtGenExpressAT1G20640-
ATTED-IIAT1G20640-
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00154DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G20640.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G64530
IntActSearch Q9LE38
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G20640
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0910150.0AY091015.1 Arabidopsis thaliana putative nodule inception protein (At1g20640) mRNA, complete cds.
GenBankAY1172370.0AY117237.1 Arabidopsis thaliana putative nodule inception protein (At1g20640) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_173488.10.0nodule inception protein-like protein 4
RefseqNP_973874.10.0nodule inception protein-like protein 4
SwissprotQ9LE380.0NLP4_ARATH; Protein NLP4
TrEMBLR0GUM30.0R0GUM3_9BRAS; Uncharacterized protein
STRINGAT1G20640.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Representative plantOGRP2991697
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  3. Schauser L,Wieloch W,Stougaard J
    Evolution of NIN-like proteins in Arabidopsis, rice, and Lotus japonicus.
    J. Mol. Evol., 2005. 60(2): p. 229-37
    [PMID:15785851]
  4. Filatov V, et al.
    Comparison of gene expression in segregating families identifies genes and genomic regions involved in a novel adaptation, zinc hyperaccumulation.
    Mol. Ecol., 2006. 15(10): p. 3045-59
    [PMID:16911220]
  5. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  6. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  7. Kim DY,Scalf M,Smith LM,Vierstra RD
    Advanced proteomic analyses yield a deep catalog of ubiquitylation targets in Arabidopsis.
    Plant Cell, 2013. 25(5): p. 1523-40
    [PMID:23667124]